Boost your Grades with us today!

assignment help b10620

write a java or R program that reads from text file. I have uploaded the text file. the text file has 424 rows (each row starts with “>gi”). each row has many column.

Example:

this is the first row  

>gi|15559516|gb|AAH14123.1| Acyl-CoA synthetase family member 2 [Homo sapiens]

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLNSKTVVQCLET

TAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQA

this is the second row

>gi|343962485|dbj|BAK62830.1| hypothetical protein [Pan troglodytes]

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSMPIGGLSYVQGCTKKHLNSKTVGQCLET

TAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQA

MELEYVLKKVGCKALVFPKQFKTQQYYNILKQICPDVENAQPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQ

the third row

>gi|194376742|dbj|BAG57517.1| unnamed protein product [Homo sapiens]

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSARGGMEAGRQRISVPSSFTASAAAHSREVDRMVSTPI

GGLSYVQGCTKKHLNSKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSY

AWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRLPDLTT

VISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHE

I want to find what are the letters that appears in specific column. Let say I want to know the letter that appear in column 1 and how many time it appears. the answer is M and it appear 2 and p 1 time.

Solution:

15% off for this assignment.

Our Prices Start at $11.99. As Our First Client, Use Coupon Code GET15 to claim 15% Discount This Month!!

Why US?

100% Confidentiality

Information about customers is confidential and never disclosed to third parties.

Timely Delivery

No missed deadlines – 97% of assignments are completed in time.

Original Writing

We complete all papers from scratch. You can get a plagiarism report.

Money Back

If you are convinced that our writer has not followed your requirements, feel free to ask for a refund.